PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10020511
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 241aa    MW: 26876 Da    PI: 8.2557
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10020511genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.81.2e-22750649
                 HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
       SRF-TF  6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                 +snrqvtfskRr g++KKA+EL++LC++e+a+i+fs+ +k + +
  Lus10020511  7 DSNRQVTFSKRRSGLFKKASELCTLCGVEIAIIVFSPGQKAFSF 50
                 79***********************************9987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.2E-22153IPR002100Transcription factor, MADS-box
PROSITE profilePS5006620.367154IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.63E-24369IPR002100Transcription factor, MADS-box
PfamPF003193.4E-24650IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-91631IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-93152IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009960Biological Processendosperm development
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MVKMVKDSNR QVTFSKRRSG LFKKASELCT LCGVEIAIIV FSPGQKAFSF GHPSIQAVVD  60
RFLARNPSKT GASSSSSSSV NTFEQLYEAH RNAQVRELNG QLTQVVQEVE RVKKYGEGLN  120
QVRKVRQRQY WWEAPIGELE LDQLHQLKAS LEELSQNMTT QKATLLNMHN SSTPPPLQFL  180
GPASATATAS SERADHHSNY ENYEDHDVKM NSDNLVMMSQ GLDSSHSNHN YQHGLYGSGF  240
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004150272.14e-70PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A0A0KWA94e-70A0A0A0KWA9_CUCSA; Uncharacterized protein
STRINGPOPTR_0009s08750.13e-62(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-49AGAMOUS-like 62